Informație

Cum pot calcula conținutul de helix alfa din elipticitatea molară?

Cum pot calcula conținutul de helix alfa din elipticitatea molară?



We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Cum pot calcula conținutul de helix alfa (adică procente) într-o proteină de la o elipticitate molară dată de 222 nm, fără a utiliza niciun software. Am încercat ecuația Greenfield-Fasman, dar răspunsul nu pare a fi corect.


Puteți folosi informațiile de pe acest site, în special secțiunea 3. (https://www.photophysics.com/resources/tutorials/circular-dichroism-cd-spectroscopy)

Observați diferitele spectre CD pentru alfa-helix, beta-sheets și bobine aleatorii. Dacă proteina dvs. este măsurată la 222 nm, trebuie să comparați valorile măsurate cu spectrele de la 222 nm, acest lucru vă va permite să estimați structura secundară a proteinei, dar dacă doriți să fiți precis, va trebui să măsurați la mai multe lungimi de undă. pentru a determina distribuția helixului alfa, a foii beta și a bobinei aleatoare. Acest lucru se datorează faptului că toate trei contribuie la spectrele de măsură și, ca atare, aveți nevoie de mai multe măsurători pentru a afla contribuțiile relative ale fiecărei structuri secundare.


Comparația proprietăților biofizice și biologice ale α-Peptide antimicrobiene enantiomerice elicoidale

În studiul nostru anterior (Chen et al. J Biol Chem 2005, 280:12316–12329), am folosit un α-peptida antimicrobiana elicoidala V681 ca cadru pentru a studia efectele hidrofobicității, amfipaticității și helicității peptidelor asupra activităților biologice în care am obținut mai multe V681 analogi cu îmbunătățire dramatică a indicilor terapeutici peptidici împotriva bacteriilor gram-negative și gram-pozitive. În studiul de față, enantiomerii d a trei peptide – V681, V13AD și V13KL au fost sintetizate pentru a compara proprietățile biofizice și biologice cu izomerii lor enantiomeri. Fiecare d-enantiomer a fost arătat prin spectroscopie circulară de dicroism ca fiind o imagine în oglindă a izomerului l corespunzător în condiții benigne și în prezența a 50% trifluoretanol. Enantiomerii l și d au prezentat activități antimicrobiene echivalente împotriva unui grup divers de Pseudomonas aeruginosa izolate clinice, diverse bacterii gram-negative și gram-pozitive și o ciupercă. În plus, peptidele l- și d-enantiomerice au fost la fel de active în capacitatea lor de a liza globulele roșii umane. Activitatea similară a peptidelor l- și d-enantiomerice pe membranele celulare procariote sau eucariote sugerează că nu există receptori chirali și membrana celulară este singura țintă pentru aceste peptide. Peptida d -V13KD a arătat îmbunătățiri semnificative ale indicilor terapeutici în comparație cu peptida părinte V681 de 53 de ori împotriva P. aeruginosa tulpini, de 80 de ori împotriva bacteriilor gram-negative, de 69 de ori împotriva bacteriilor gram-pozitive și de 33 de ori împotriva Candida albicans. Stabilitatea excelentă a enantiomerilor d la digestia cu tripsină (fără proteoliză de către tripsină) în comparație cu descompunerea rapidă a enantiomerilor l evidențiază avantajul enantiomerilor d și potențialul lor ca terapie clinică.

Utilizarea pe scară largă a antibioticelor tradiționale a dus la apariția multor tulpini rezistente la antibiotice, determinând o nevoie urgentă de o nouă clasă de antibiotice (1, 2). Peptidele antimicrobiene cationice au devenit candidați importanți ca potențiali agenți terapeutici ( 3-5 ) și s-au dovedit a fi active în in vivo studii pe animale ( 6 ). Deși nu a fost stabilit modul exact de acțiune al peptidelor antimicrobiene (7-9), s-a propus că membrana citoplasmatică este ținta principală pentru multe dintre aceste peptide, prin care acumularea de peptide în membrană determină o permeabilitate crescută și pierderea barierei. funcția ( 10, 11 ). Dezvoltarea rezistenței la peptidele active membranare a căror unică țintă este membrana citoplasmatică nu este de așteptat, deoarece aceasta ar necesita modificări substanțiale în compoziția lipidică a membranelor celulare ale microorganismelor. Cu toate acestea, bariera majoră în calea utilizării peptidelor antimicrobiene ca antibiotice este toxicitatea sau capacitatea acestora de a liza celulele eucariote, exprimată în mod normal ca activitate hemolitică (toxicitate asupra globulelor roșii umane), care este un motiv principal care împiedică aplicarea lor ca terapie injectabilă.

Formele enantiomerice de peptide antimicrobiene cu toți d-aminoacizii au fost folosite pentru a studia mecanismul de legare a membranei (12-14), deoarece se credea anterior că chiralitatea membranei celulare ar necesita o chiralitate specifică a peptidei pentru ca aceasta să fie activă. Cu toate acestea, multe studii au arătat că peptidele cu toate d-aminoacizii au activități egale cu toate enantiomerii lor (12-19), sugerând că mecanismul antimicrobian al acestor peptide nu implică o interacțiune stereoselectivă cu o enzimă sau lipide chirală. sau receptor de proteine. În plus, toate-d-peptidele sunt rezistente la degradarea enzimelor proteolitice, ceea ce le sporește potențialul ca terapie clinică.

În studiul nostru anterior (20), am folosit a de novo abordare de proiectare pentru a modifica structura secundară, hidrofobicitatea și amfipaticitatea unui α-peptida antimicrobiană amfipatică elicoidală V681 (21, 22) și au obținut compuși de plumb cu activități antimicrobiene ridicate și activitate hemolitică extrem de scăzută. În studiul de față, comparăm proprietățile biofizice și biologice dintre enantiomerii peptidici cu toți l-sau toți-d-aminoacizii compușilor noștri de plumb, inclusiv activitățile antimicrobiene împotriva diferitelor tulpini bacteriene, în special a unui grup divers de Pseudomonas aeruginosa izolate clinice cu o gamă largă de sensibilitate la antibioticul ciprofloxacin. Este bine cunoscut faptul că infecţiile respiratorii prin P. aeruginosa sunt cauza majoră de morbiditate și mortalitate la pacienții adulți cu fibroză chistică (23-25). Pseudomonas aeruginosa infecția este o problemă serioasă și la pacienții internați cu cancer și arsuri, letalitatea la astfel de pacienți fiind de 50% ( 24, 25 ). Conform datelor colectate din 1990 până în 1996 de către Centrul SUA pentru Controlul și Prevenirea Bolilor (CDC), P. aeruginosa a fost a doua cea mai frecventă cauză de pneumonie nosocomială (17% din izolate), a treia cea mai frecventă cauză de infecții ale tractului urinar (11%), a patra cea mai frecventă cauză de infecții ale locului chirurgical (8%), al șaptelea cel mai frecvent agent patogen izolat. din fluxul sanguin (3%) și al cincilea cel mai frecvent izolat în general (9%). Noi credem că, acest comparativ de novo studiul de proiectare al peptidelor antimicrobiene l - și d este pasul critic către dezvoltarea de noi terapii antimicrobiene și înțelegerea mecanismului de acțiune al α-peptide antimicrobiene elicoidale.


MATERIALE ȘI METODE

Plasmide

Plasmida de expresie Pho4p pJ1080, derivată dintr-un pET21d (Novagen), codifică domeniul de 62 de aminoacizi bHLH al Pho4p și a fost darul lui D. Wemmer ( 59). Mutageneza direcționată pe situs folosind metode standard a fost utilizată pentru a genera plasmide care codifică bHLHMIC DE STATURA Variante de încărcare Pho4p pJ1350, pJ1351 și pJ1352 (reziduuri care codifică SAA, EEE și KKK atașate lângă capătul N-terminal). Peptide cu variante de încărcare mai lungă, bHLHLUNG (SAA, EEE, KKK) au fost generate din bHLHMIC DE STATURA peptide prin înlocuirea primelor 3 resturi N-terminale (MDD) cu 12 reziduuri N-terminale bZIP (MASMTGGQQMGRD). Plasmidele pDP-AP-1-21, pDP-AP-1-23, pDP-AP-1-25, pDP-AP-1-26, pDP-AP-1-28 și pDP-AP-1-30 au fost modificate pentru a include un site E-box pentru legarea bHLH pentru a genera sonde pentru analize de fază electroforetică ( 30).

Oligonucleotide

Oligonucleotidele nemodificate au fost sintetizate utilizând chimia standard a fosforamiditelor. Oligonucleotidele au fost purificate prin denaturarea PAGE (20% acrilamidă 29:1 acrilamidă/bisacrilamidă, 8 M uree), extrase din fragmente de gel (10 mM Tris-HCl, 1 mM EDTA și 300 mM NaOAc, pH 5,2) și desarate folosind C18 cartușe cu fază inversă (Sep-Pak Waters Corporation). Concentrațiile de oligonucleotide au fost determinate la 260 nm folosind coeficienții de extincție molar vecin cel mai apropiat, așa cum s-a descris anterior ( 11). Oligonucleotidele au fost recoapte la ~50 μM în 250 mM NaCI, prin încălzire la 95°C și răcire la temperatura camerei peste noapte.

Exprimarea și purificarea proteinelor

Peptidele bHLH au fost exprimate în celule BL21 (DE3) în mediul Luria-Bertani ( 59). Culturile au fost crescute la 37°C până la un A600 de 0,6–0,7 și indus cu izopropil-β-d-tiogalactopiranozidă 5 mM. Culturile induse au fost apoi incubate 8 ore la 37°C înainte de centrifugare (5000 × g, 20 min). Peletele celulare au fost congelate la -80°C, decongelate și resuspendate (20 ml/l cultură) în tampon de liză (50 mM Tris-HCl, pH 6,0, 1 mM EDTA și 20 mM DTT). Liza inițială a celulelor prin sonicare (15 s fiecare, 10 × 4°C Fisher Sonic Dismembrator 60) a fost urmată de tăiere pneumatică folosind un disruptor Avestin Emulsiflex-C5 acţionat de N sub presiune.2 (140 psi, 4°C). Lizatele brute rezultate au fost clarificate prin centrifugare (20 000 × g, 45 min, 4°C) și purificat în continuare pe o coloană cu flux gravitațional SP sepharose (Pharmacia Biotech, Suedia). După încărcare, coloana schimbătoare de cationi a fost spălată cu trepte de 40 ml de tampon de liză suplimentat cu concentrații crescătoare de sare (0,5, 1,0, 1,5 și 2,0 M NaCI). Fracții eluate care conțin peptidele bHLH (1,0 M NaCI pentru bHLHMIC DE STATURA şi 1,5 M NaCI pentru bHLHLUNG) au fost concentrate utilizând concentratoare centrifugale cu limitare de greutate moleculară de 5000 (VivaSpin 20 VivaScience) și apoi purificate prin HPLC [C18 Coloană preparativă cu fază inversă (250 × 21,2 mm), Beckman 127P System Gold, tampon A: 0,1% acid trifluoracetic (TFA), tampon B: 80% CH3CN, 0,1% TFA, gradient 10–70% tampon B peste 50 min]. Puritatea peptidei a fost evaluată prin ESI GC-MS ca fiind >95%. Peptidele purificate au fost liofilizate pentru depozitare.

BHLH: studii de afinitate de legare la ADN

Spectroscopie circulară de dicroism

Testele de fază electroforetică ale îndoirii ADN-ului

Au fost generate și radiomarcate prin PCR sonde ADN pentru analizele de fazare din derivați ai plasmidelor pDP-AP-1-21, pDP-AP-1-23, pDP-AP-1-25, pDP-AP-1-26, pDP-AP -1-28 și pDP-AP-1-30 (30) care au fost modificate prin mutageneza dirijată pe situs a situsului original de legare AP-1 pentru a genera situsuri de legare la cutia E adecvate pentru legarea bHLH. Sondele ADN au fost incubate cu suficientă peptidă pentru o schimbare a mobilității de aproximativ 50% în reacții de 20 μl care conțineau tampon de legare și 100 μg/ml BSA. Reacțiile au fost incubate pe gheață timp de 30 de minute înainte de PAGE nativ (6% acrilamidă 29:1 acrilamidă/bisacrilamidă) în tampon TBE 0,5 x timp de 2000 V-h la 22°C. Gelurile uscate au fost analizate ca mai sus.

Calcule de analiză în faze

Predicții de energie de curbare a ADN-ului

ΔΔG° contribuții la procesul general de formare a complexului proteină-ADN, definit ca ΔG°(varianta) − ΔG°(SAA), au fost estimate din date experimentale sau au fost propuse ca presupuneri rezonabile care raționalizează observațiile experimentale. Individul ΔΔG° contribuțiile care provin din experiment au fost estimate după cum urmează:


Efectul pH-ului acid asupra adsorbției și activității litice a peptidelor Polybia-MP1 și analogul său care conține histidină în membrana lipidelor anionice: un studiu biofizic prin dinamică moleculară și spectroscopie

Peptidele antimicrobiene (AMP) fac parte din sistemul imunitar înnăscut al multor specii. AMP-urile sunt secvențe scurte bogate în reziduuri încărcate și nepolare. Acţionează asupra fazei lipidice a membranei plasmatice fără a necesita receptori membranari. Polybia-MP1 (MP1), extras dintr-o viespă nativă, este un bactericid cu spectru larg, un inhibitor al proliferării celulelor canceroase fiind nehemolitic și necitotoxic. Mecanismul de acțiune al MP1 și modul său de adsorbție nu sunt încă complet cunoscute. Adsorbția sa la bistratul lipidic și activitatea litică depinde cel mai probabil de starea de ionizare a celor două reziduuri acide și a celor trei reziduuri bazice și, în consecință, de pH-ul în vrac. Aici am investigat efectul soluției acide în vrac (pH 5,5) și pH neutru (7,4) asupra adsorbției, inserției și activității litice a MP1 și a analogului său H-MP1 la membrana modelului anionic (7POPC: 3POPG). H-MP1 este un analog sintetic al MP1 cu lizinele înlocuite cu histidine. Modificările globale ale pH-ului ar putea modula eficiența acestei peptide. Combinația de diferite tehnici experimentale și simulări de dinamică moleculară (MD) a arătat că adsorbția, inserția și activitatea litică a H-MP1 sunt foarte sensibile la pH-ul în vrac în opoziție cu MP1. Detaliile atomistice, furnizate de simulările MD, au arătat că peptidele își contactează N-terminele cu stratul dublu înainte de inserție și apoi se așează paralel cu stratul dublu. Fețele lor hidrofobe introduse în faza lanțului acil perturbă împachetarea lipidelor.

Aceasta este o previzualizare a conținutului abonamentului, accesat prin instituția dumneavoastră.


Materiale și metode

Modele

Secvența HS (secvența cameleon-HS ca fragment izolat) este VLYVKLHN. Am luat în considerare în continuare cele două secvențe, HS-α și HS-β prezentate în Figura 1, pentru a investiga modul în care reziduurile de flancare afectează tendințele de pliere. Lungimea reziduurilor adăugate la secvența HS este suficient de lungă pentru a include cel puțin o unitate de structură secundară, adică o α-helix și două β-toroane sau β-foaie/ac de păr (vezi Figura 1). ). În plus, o a doua secvență de cameleon, secvența cameleon lungă cu șapte reziduuri-HE (Helix și foaie), RVQDNIV a fost studiată așa cum este descris în Informațiile de sprijin).

Modelare moleculară

Pentru a îmbunătăți eșantionarea în simulările de dinamică moleculară, este utilizată metoda REMD 43. Se realizează prin rularea unui set de simulări independente la diferite temperaturi și schimburi determinate de criteriul Metropolis în fiecare perioadă de timp. Se știe că REMD este o metodă eficientă de eșantionare 44 și a fost aplicată cu succes la α-peptide elicoidale, 34, 45� β peptide, 47 β-peptide în ac de păr 48 , proteine ​​mici și un myloid 49 asamblare. 20, 50� Metoda REMD bazată pe temperatură, care permite eșantionarea conformațională îmbunătățită, este un instrument adecvat pentru studierea plasticității structurale a secvenței cameleonilor izolate HS și a factorilor care induc secvențele cameleonilor să se plieze într-o conformație α-helix. în HS-α și un β-ac de păr în HS-β. Detalii despre parametrii și setările de simulare pot fi găsite în secțiunea Informații suport S1.

Spectrometrie de masă cu mobilitate ionică

Spectrometria de masă bazată pe mobilitatea ionică (IM-MS) a fost utilizată pentru a măsura secțiunile transversale de coliziune ale monomerilor peptidelor HS-α și HS-β. Valorile experimentale au fost comparate cu secțiuni transversale teoretice ale structurilor obținute din simulări. Aici, ionii sunt generați prin nano-electrospray, capturați de un capilar, transferați într-o pâlnie ionică, desolvați ușor, prinși și pulsați într-o celulă de derivă umplută cu gaz heliu. Pachetul de ioni este tras prin celulă de un câmp electric slab, iese din celulă, este selectat în masă și detectat. Filtrul de masă poate fi setat să selecteze o anumită valoare a m/z și o distribuție a timpului de sosire măsurată, cu t = 0 stabilit de puls în celulă și t = tA când ionii ajung la detector. Prin variarea tensiunii pe celulă la presiune constantă a celulei valori foarte precise ale reduse K0, poate fi obtinut. Aceste valori pot fi transformate în secțiuni transversale de coliziune folosind o relație bine stabilită de teorie cinetică. 55 Dacă se dorește spectre de masă, ionii sunt transmisi continuu de la pâlnia ionică la celula de deriva. În experimentele descrise aici s-au folosit două celule IM-MS separate, una cu o celulă de derivă scurtă (5 cm) 56 și una cu o celulă mult mai lungă (2 m). 57 Ultimul instrument are o rezoluție mult mai mare și, datorită designului sursei sale, transferă foarte ușor ionii din picăturile nano-electrospray către celula de deriva. Acest lucru este important pentru a păstra structuri asemănătoare soluției pentru determinarea secțiunii transversale. 58�

Microscopia electronică cu transmisie și dicroismul circular

Imaginile microscopiei electronice cu transmisie (TEM) au fost luate la t = 0 și t = 480 h folosind un microscop electronic cu transmisie JEOL 1200 EX cu o tensiune de accelerare de 80 kV. Spectrele de dicroism circulare au fost luate folosind un spectrometru circular de dicroism Aviv model 202 (Instruments Inc.) și un spectropolarimetru J-810 (JASCO, Tokyo, Japonia) pentru studii de timp. Procedurile experimentale detaliate sunt descrise în detaliu în secțiunile Informații justificative S1.3 și S1.4.


Dicroism circular Edit

Dicroism circular (CD) este dicroismul care implică lumină polarizată circular, adică absorbția diferențială a luminii pentru stânga și dreapta. Lumina polarizată circulară stânga (LHC) și circulară dreaptă (RHC) reprezintă două stări posibile de moment unghiular de rotație pentru un foton. Acest fenomen se manifestă în benzile de absorbție ale moleculelor chirale optic active. Spectroscopia CD are o gamă largă de aplicații. Cel mai important, UV CD este folosit pentru a investiga structura secundară a proteinelor.

CD-ul este strâns legat de dispersie optică rotativă (ORD) tehnică și este, în general, considerată a fi mai avansată. CD este măsurat în sau în apropierea benzilor de absorbție ale moleculei de interes, în timp ce ORD poate fi măsurată departe de aceste benzi. Avantajul CD este evident în analiza datelor. Elementele structurale se disting mai clar, deoarece benzile lor înregistrate nu se suprapun extensiv la anumite lungimi de undă, așa cum se întâmplă în ORD. În principiu, aceste două măsurători spectrale pot fi interconvertite printr-o transformare integrală, dacă toate absorbțiile sunt incluse în măsurători.

Principii fizice Edit

Radiația electromagnetică constă dintr-un câmp electric (E) și magnetic (B) care oscilează perpendicular unul pe celălalt și pe direcția de propagare, o undă transversală. În timp ce lumina polarizată liniar apare atunci când vectorul câmpului electric oscilează doar într-un plan, lumina polarizată circular apare atunci când direcția vectorului câmpului electric se rotește în jurul direcției de propagare, în timp ce vectorul păstrează magnitudinea constantă. Într-un singur punct din spațiu, vectorul polarizat circular va trasa un cerc pe o perioadă a frecvenței undei, de unde și numele. Cele două diagrame de mai jos arată vectorii electrici ai luminii polarizate liniar și circular, la un moment dat, pentru o serie de poziții, graficul vectorului electric polarizat circular formează o spirală de-a lungul direcției de propagare (k). Pentru lumina polarizată circular la stânga (LCP) cu propagare către observator, vectorul electric se rotește în sens invers acelor de ceasornic. Pentru lumina polarizată circular drept (RCP), vectorul electric se rotește în sensul acelor de ceasornic.

Când lumina polarizată circular trece printr-un mediu absorbant optic activ, vitezele dintre polarizările din dreapta și din stânga diferă, precum și lungimea lor de undă și măsura în care sunt absorbite (εL≠εR). Dicroism circular este diferența Δε ≡ εL- εR.

Mai simplu spus, deoarece lumina polarizată circular este însăși „chirală”, ea interacționează diferit cu moleculele chirale. Adică, cele două tipuri de lumină polarizată circular sunt absorbite în grade diferite. Într-un experiment CD, cantități egale de lumină polarizată circular stânga și dreapta de o lungime de undă selectată sunt radiate alternativ într-o probă (chirală). Una dintre cele două polarizări este absorbită mai mult decât cealaltă, iar această diferență de absorbție dependentă de lungimea de undă este măsurată, obținând spectrul CD al probei. Datorită interacțiunii cu molecula, vectorul câmpului electric al luminii urmărește o cale eliptică după trecerea prin eșantion.

Este important ca chiralitatea moleculei să poată fi conformațională mai degrabă decât structurală. Adică, de exemplu, o moleculă de proteină cu o structură secundară elicoidală poate avea un CD care se modifică odată cu modificările conformației.

unde ΔA este diferența dintre absorbanța luminii polarizate circular stâng (LCP) și luminii polarizate circular dreapta (RCP) (acesta este de obicei măsurat). ΔA este o funcție a lungimii de undă, deci pentru ca o măsurătoare să fie semnificativă, trebuie cunoscută lungimea de undă la care a fost efectuată.

Dicroismul circular molar este definit ca

unde εL și εR sunt coeficienții molar de extincție pentru lumina LCP și RCP.

Deși ΔA este de obicei măsurat, din motive istorice, majoritatea măsurătorilor sunt raportate în grade de elipticitate. Elipticitatea molară este dicroismul circular corectat pentru concentrație. Dicroismul circular molar și elipticitatea molară, [θ], sunt ușor interconvertite prin ecuația:

În multe aplicații practice ale dicroismului circular (CD), CD măsurat nu este pur și simplu o proprietate intrinsecă a moleculei, ci depinde mai degrabă de conformația moleculară. Într-un astfel de caz, CD-ul poate fi, de asemenea, o funcție de temperatură, concentrație și mediul chimic, inclusiv solvenți. În acest caz, valoarea CD raportată trebuie să specifice și acești alți factori relevanți pentru a fi semnificativă.

Aplicație la moleculele biologice Edit

Spectrul CD al UV departe (ultraviolet) al proteinelor poate dezvălui caracteristici importante ale structurii lor secundare. Spectrele CD pot fi utilizate cu ușurință pentru a estima fracțiunea unei molecule care se află în conformația alfa-helix, conformația beta-sheet, conformația beta-turn sau o altă conformație (de exemplu bobina aleatorie). Aceste atribuiri fracționale pun constrângeri importante asupra posibilelor conformații secundare în care se poate afla proteina. CD nu poate spune, în general, unde elicele alfa care sunt detectate sunt situate în moleculă sau chiar să prezică complet câte sunt. În ciuda acestui fapt, CD-ul este un instrument valoros, mai ales pentru a arăta modificările conformației. Poate fi folosit, de exemplu, pentru a studia modul în care structura secundară a unei molecule se modifică în funcție de temperatură sau de concentrația agenților de denaturare, de ex. Clorura de guanidiniu sau uree. În acest fel, poate dezvălui informații termodinamice importante despre moleculă (cum ar fi entalpia și energia liberă Gibbs de denaturare) care nu pot fi obținute cu ușurință altfel. Oricine încearcă să studieze o proteină va găsi CD un instrument valoros pentru a verifica dacă proteina este în conformația sa nativă înainte de a întreprinde experimente extinse și/sau costisitoare cu ea. De asemenea, există o serie de alte utilizări pentru spectroscopia CD în chimia proteinelor care nu sunt legate de estimarea fracției alfa-helix.

Spectrul CD aproape UV (>250 nm) al proteinelor oferă informații despre structura terțiară. Semnalele obținute în regiunea 250–300 nm se datorează absorbției, orientării dipolului și naturii mediului înconjurător a aminoacizilor fenilalanină, tirozină, cisteină (sau punți disulfură S-S) și triptofan. Spre deosebire de CD-ul cu UV îndepărtat, spectrul CD-ului aproape UV nu poate fi atribuit unei anumite structuri 3D. Mai degrabă, spectrele CD aproape UV oferă informații structurale despre natura grupărilor protetice din proteine, de exemplu, grupele hem din hemoglobină și citocromul c.

Spectroscopia CD-ului vizibil este o tehnică foarte puternică pentru a studia interacțiunile metal-proteină și poate rezolva tranzițiile electronice d-d individuale ca benzi separate. Spectrele CD din regiunea luminii vizibile sunt produse numai atunci când un ion metalic se află într-un mediu chiral, astfel încât ionii metalici liberi în soluție nu sunt detectați. Acest lucru are avantajul de a observa doar metalul legat de proteine, astfel încât dependența de pH și stoichiometriile sunt ușor obținute.

CD-ul oferă informații structurale mai puțin specifice decât cristalografia cu raze X și spectroscopia RMN a proteinelor, de exemplu, care ambele oferă date de rezoluție atomică. Cu toate acestea, spectroscopia CD este o metodă rapidă care nu necesită cantități mari de proteine ​​sau procesare extinsă a datelor. Astfel, CD poate fi utilizat pentru a studia un număr mare de condiții de solvenți, temperatură variabilă, pH, salinitate și prezența diferiților cofactori.

Limitări experimentale Edit

Spectroscopia CD este de obicei folosită pentru a studia proteinele în soluție și, astfel, completează metodele care studiază starea solidă. Aceasta este, de asemenea, o limitare, prin faptul că multe proteine ​​sunt încorporate în membrane în starea lor nativă, iar soluțiile care conțin structuri membranare sunt adesea puternic împrăștiate.

Măsurarea CD este complicată de faptul că sistemele tampon apoase tipice absorb adesea în intervalul în care caracteristicile structurale prezintă o absorbție diferențială a luminii polarizate circular. Tampoanele fosfat, sulfat, carbonat și acetat sunt în general incompatibile cu CD, dacă nu sunt extrem de diluate, de ex. în intervalul 10–50 mM. Sistemul tampon Tris ar trebui evitat complet atunci când se execută CD-ul cu UV departe. Compușii de borat și oniu sunt adesea utilizați pentru a stabili intervalul adecvat de pH pentru experimentele CD. Unii experimentatori au înlocuit ionul de clorură cu fluor, deoarece fluorul absoarbe mai puțin în UV îndepărtat, iar unii au funcționat în apă pură. O altă tehnică, aproape universală, este de a minimiza absorbția solvenților prin utilizarea celulelor cu lungime de cale mai scurtă atunci când se lucrează în UV îndepărtat, lungimi de cale de 0,1 mm nu sunt neobișnuite în această lucrare.

Pe lângă măsurarea în sisteme apoase, CD, în special CD-ul UV departe, poate fi măsurat în solvenți organici, de ex. etanol, metanol sau trifluoretanol (TFE). Acesta din urmă are avantajul de a induce formarea structurii proteinelor, inducând foi de beta în unele și elice alfa în altele, pe care nu le-ar prezenta în condiții apoase normale. Cei mai obișnuiți solvenți organici, cum ar fi acetonitril, THF, cloroform, diclormetan, sunt totuși incompatibili cu UV departe CD.

Poate fi interesant de observat că spectrele proteinei CD utilizate în estimarea structurii secundare sunt legate de absorbțiile orbitale π la π* ale legăturilor amidice care leagă aminoacizii. Aceste benzi de absorbție se află parțial în așa-numitul ultraviolet în vid (lungimi de undă mai mici de aproximativ 200 nm). Regiunea de lungime de undă de interes este de fapt inaccesibilă în aer din cauza absorbției puternice a luminii de către oxigen la aceste lungimi de undă. În practică, aceste spectre sunt măsurate nu în vid, ci într-un instrument fără oxigen (umplut cu azot pur).


2. Experimental

2.1. Instrumente și reactivi

Soluții stoc de 5 × 10 −3 mol L −1 NFZ și NFT (Sigma Chemical Co., St. Louis, SUA puritate – nu mai puțin de 99,0%) au fost preparate prin dizolvarea cristalelor lor (9,91 × 10) −3 g și 1,19 × 10 −2 g, respectiv) în 10 mL dimetil formamidă (DMF). BSA (2 × 10 −3 mol L −1 ) a fost preparată prin dizolvarea a 1,36 g de proteină (M = 66 kDa, ≥98%, pulbere liofilizată achiziționată de la Sigma-Aldrich Chemical Co. Ltd. și fără purificare suplimentară) în 10,0 mL 5,0 × 10 −2 mol L −1 soluție de clorură de sodiu și păstrată la 4 °C. Pentru a confirma puritatea BSA preparat, acesta a fost diluat la 2,0 × 10 −5 mol L −1 , iar valoarea măsurată a absorbanţei a fost (0,896) la 278 nm. Aceasta a fost comparată cu o absorbanță de 0,667 de la o referință de 1,0 g L −1 (1.47 × 10 −5 mol L −1 ) BSA pur. 16 Toate soluțiile experimentale au fost ajustate cu tampon Tris-HCl ((hidroximetil)amino metan-acid clorhidric) la pH 7,4. Alte substanțe chimice au fost reactivi de calitate analitică și a fost folosită apă dublu distilată.

2.2. Studiu de stingere a fluorescenței

2.3. Măsurători FT-IR

2.4. Studii de dicroism circular (CD) și împrăștiere a luminii prin rezonanță (RLS) pentru interacțiune

2.5. Măsurători prin microscopie de forță atomică (AFM).

2.6. Studii de andocare moleculară


  1. Un situs de clivaj prohormon convertază într-un alfa-helix prezis mediază sortarea polipeptidei neuronale și endocrine VGF în calea secretorie reglată.
    Garcia şi colab.
    J.Biol.Chem., 2005280:41595
  2. Studiu comparativ al buzunarelor de legare a proprotein convertazelor de mamifere și implicațiile sale pentru proiectarea inhibitorilor specifici de molecule mici.
    Tian și Jianhua
    Int.J.Biol.Sci., 20106:89
  3. Inhibarea procesării proendotelinei-1 în legătură cu convertază.
    Denault et al.
    J.Cardiovasc.Pharmacol., 199526:S47
  4. Inhibitorii de furin blochează scindarea proteinei spike SARS-CoV-2 pentru a suprima producția de virus și efectele citopatice.
    Cheng şi colab.
    Cell Rep., 2020

Citatele enumerate mai jos sunt publicații care folosesc produsele Tocris. Citările selectate pentru Decanoyl-RVKR-CMK includ:

6 Citate: Afișează 1 - 6

  1. Un loc de clivaj multibazic în proteina Spike a SARS-CoV-2 este esențial pentru infectarea celulelor pulmonare umane.
    Autori: Hoffman et al.
    Mol Cell 202078:779
  2. Inhibitorii de furin blochează scindarea proteinei spike SARS-CoV-2 pentru a suprima producția de virus și efectele citopatice.
    Autori: Cheng et al.
    Cell Rep. 202033:108254
  3. Model Biowire al fibrozei cardiace interstițiale și focale.
    Autori: Wang et al.
    ACS Cent Sci 20195:1146
  4. Sindromul respirator din Orientul Mijlociu Proteina Spike Coronavirus nu este activată direct de furina celulară în timpul intrării virale în celulele țintă.
    Autori: Matsuyama et al.
    J Virol 201892
  5. Rolul interleukinei-13 în îndepărtarea hiper-radiosensibilității prin iradierea amorsă.
    Autori: Edin
    Am J Physiol Gastrointest Ficat Physiol 201455:1066
  6. Intrarea în celula gazdă a coronavirusului sindromului respirator din Orientul Mijlociu după activarea în doi pași, mediată de furină, a proteinei spike.
    Autori: Millet & Whittaker
    Proc Natl Acad Sci U S A 2014111:15214

Nu există întrebări frecvente specifice pentru acest produs, cu toate acestea

Recenzii pentru Decanoyl-RVKR-CMK

Momentan nu există recenzii pentru acest produs. Fii primul care scrie un comentariu pentru Decanoyl-RVKR-CMK și câștigă recompense!


Rezultate

Descrierea și analiza evolutivă a variațiilor microstructurale în proteina umană Bcl2l10

Informațiile detaliate privind structură-funcție sunt cunoscute în prezent doar pentru un număr limitat de proteine ​​​​ovocitelor, ceea ce înseamnă că înțelegerea noastră de bază a actorilor moleculari care conduc maturizarea, fertilizarea și dezvoltarea preimplantării ovulelor este foarte limitată. Pe lângă faptul că este paralogul proeminent al Bcl-2 exprimat matern ( Burns et al. 2003 Hamatani et al. 2004 Arnaud et al. 2006 Gallardo et al. 2007 Guillemin et al. 2009 Yoon et al. 2009), Bcl2l10 a suferit o evoluție accelerată vertebrate ( Aouacheria et al. 2001, 2005 Guillemin et al. 2009). Pentru a identifica secvențele specifice de aminoacizi responsabile pentru nivelurile ridicate de divergență observate în acest grup de ortologie, am generat mai întâi o aliniere a secvenței multiple de ortologi Bcl2l10 de la mai multe mamifere, păsări și pești, precum și un virus (fig. 1). Din această comparație, reiese că virajul interhelical situat între elicele α5 și α6 prezise poartă o duzină suplimentară de aminoacizi în Bcl2l10 uman care nu sunt prezenți în proteinele omoloage de la pui sau pește-zebra. Mai mult, Bcl2l10 uman are o extensie de 10 aminoacizi la capătul său N-terminal în comparație cu secvențele ortologe din Mnoi muschii și alte vertebrate nonprimate. Produsul prezis codificat de om Bcl2l10 gena a fost descrisă ca o proteină lungă de 194- ( Aouacheria et al. 2001) sau 204-aminoacizi ( Ke et al. 2001 Zhang et al. 2001), în funcție de absența sau prezența acestei extensii. Prima regiune a fost denumită LAAS (pentru L ong A mino Acid S tretch într-o publicație anterioară (Zhang et al. 2001)) și, prin analogie, am decis să o denumim pe a doua SAAS (pentru S hort A mino Acid S tretch).

Alinierea secvenței multiple a proteinelor Bcl2l10 ortologe. Cele șapte specii utilizate au fost următoarele: Homo sapiens (NP_065129), Mus musculus (Q9Z0F3), Gallus gallus (Q90ZN1), Coturnix coturnix (CAA59136), Herpesvirusul Meleagrid 1 (AAG30102), Danio rerio (NP_919379) și Gadus morhua (ACZ62638). The conserved BH1–BH4 motifs and the C-terminal transmembrane (TM) domain are indicated above the alignment. The SAAS and LAAS motifs are boxed. The locations of the predicted pore-forming α5 and α6 helices are indicated above the sequence of human Bcl2l10. The presence of a 22-kDa polypeptide corresponding to the form shown in the figure was previously confirmed by western blot analysis of human ovary extracts ( Guillemin et al. 2009).

Multiple sequence alignment of orthologous Bcl2l10 proteins. The seven species used were as follows: Homo sapiens (NP_065129), Mus musculus (Q9Z0F3), Gallus gallus (Q90ZN1), Coturnix coturnix (CAA59136), Meleagrid herpesvirus 1 (AAG30102), Danio rerio (NP_919379), and Gadus morhua (ACZ62638). The conserved BH1–BH4 motifs and the C-terminal transmembrane (TM) domain are indicated above the alignment. The SAAS and LAAS motifs are boxed. The locations of the predicted pore-forming α5 and α6 helices are indicated above the sequence of human Bcl2l10. The presence of a 22-kDa polypeptide corresponding to the form shown in the figure was previously confirmed by western blot analysis of human ovary extracts ( Guillemin et al. 2009).

As a first step in deciphering the evolutionary mechanisms for the appearance of these regions, we have compiled and aligned Bcl2l10 amino acid sequences obtained from publicly available databases ( Blaineau and Aouacheria 2009) or cloned by PCR using genomic DNA from different species, followed by sequencing.

On the one hand, we found that the SAAS region was present in great apes (humans, gorillas, chimps, and orangutans) and absent in gibbons and other monkeys (baboons, macaques, and lemurs) ( fig. 2A) as well as other vertebrates ( supplementary fig. S1 , Supplementary Material online), suggesting that the event giving rise to this N-terminal extension occurred after the Old World monkey–hominoid split and after separation of the lesser apes from the other anthropoid lineages ∼14 to 18 Ma ( Goodman et al. 2005). After careful inspection of the nucleotide alignment ( fig. 2B), it was determined that in anthropoid primates Bcl2l10 contains an internal tandem duplication in which the upstream 30 base pairs are repeated and results in the addition of ten amino acids to the N-terminus (corresponding to the SAAS segment).

Sequence and evolutionary analysis of the SAAS motif of Bcl2l10. (A) Amino acid sequence alignment of the N-terminal region of Bcl2l10 from 11 primates. Right: Schematic phylogeny of the primate species used in the present study (adapted from Goodman et al. 2009). The Bcl2l10 protein found in anthropoid primates (anthropoids) has an extension of ten amino acids in the N-terminal side compared with other primates (others). Arrows denote the first in-frame methionine in each group. (B) Alignment of nucleotide sequences determined for the N-terminal region of primate Bcl2l10. The two tandem duplication units (shown in brackets) are bordered on each side by an “ACC” triplet (dotted lines). Possible tandem duplication history (repeat/ancestral) is indicated above the alignment. Arrows denote the start codon ATG found in Bcl2l10 from anthropoids versus other primates. Species abbreviations refer to full names given in (A). Sequences for Homo sapiens, Pan troglodytes, Pongo pygmaeus, Macaca mulatta, Tarsius syrichta, și Otolemur garnettii were from Ensembl (respective accession numbers: ENSG00000137875, ENSPTRG00000007083, ENSPPYG00000006483, ENSMMUG00000017372, ENSTSYG00000013586, and ENSOGAG00000008687). Sequences for Gorilla gorilla, Callithrix jacchus, Nomascus leucogenys, Papio anubis, și Chlorocebus aethiops were deduced from cloned partial ORFs (see Materials and Methods). (C) Alignments of nucleotide (left) and amino acid (inset) sequence repeats found in human Bcl2l10.

Sequence and evolutionary analysis of the SAAS motif of Bcl2l10. (A) Amino acid sequence alignment of the N-terminal region of Bcl2l10 from 11 primates. Right: Schematic phylogeny of the primate species used in the present study (adapted from Goodman et al. 2009). The Bcl2l10 protein found in anthropoid primates (anthropoids) has an extension of ten amino acids in the N-terminal side compared with other primates (others). Arrows denote the first in-frame methionine in each group. (B) Alignment of nucleotide sequences determined for the N-terminal region of primate Bcl2l10. The two tandem duplication units (shown in brackets) are bordered on each side by an “ACC” triplet (dotted lines). Possible tandem duplication history (repeat/ancestral) is indicated above the alignment. Arrows denote the start codon ATG found in Bcl2l10 from anthropoids versus other primates. Species abbreviations refer to full names given in (A). Sequences for Homo sapiens, Pan troglodytes, Pongo pygmaeus, Macaca mulatta, Tarsius syrichta, și Otolemur garnettii were from Ensembl (respective accession numbers: ENSG00000137875, ENSPTRG00000007083, ENSPPYG00000006483, ENSMMUG00000017372, ENSTSYG00000013586, and ENSOGAG00000008687). Sequences for Gorilla gorilla, Callithrix jacchus, Nomascus leucogenys, Papio anubis, și Chlorocebus aethiops were deduced from cloned partial ORFs (see Materials and Methods). (C) Alignments of nucleotide (left) and amino acid (inset) sequence repeats found in human Bcl2l10.

On the other hand, the α5–α6 interhelical region of Bcl2l10 exhibits variability both in sequence and in length across vertebrate species ( fig. 3A and B). Indeed, the Bcl2l10 protein found in primates, Felis catus and euteleostean fishes, has a long α5–α6 linker, whereas most orthologous proteins present in the other lineages have a shorter interhelical region with unrelated amino acids. Such hypervariability in the LAAS region likely reflects complex patterns of mutation and selection, which perhaps took place after an initial insertion event in the early evolution of the bcl2l10 gene (most probably at the time vertebrates diverged from invertebrates, i.e., when most paralogous genes within the Bcl-2 family were formed— Aouacheria et al. 2005).

The α5–α6 interhelical region of Bcl2l10 has variability in length and in sequence across vertebrate species. (A) Length of the α5–α6 linker of Bcl2l10 in various vertebrates. All sequences were extracted from Ensembl database (version 58). Proposed phylogeny was adapted from Milinkovitch et al. (2010). Ma, million years ago. (B) Multiple sequence alignment of the region located between the predicted α5 and α6 helices of Bcl2l10. Species abbreviations refer to full names given in (A). The α5–α6 connecting region of Bcl2l10 (named LAAS in the human protein) is highly variable in amino acid sequence between vertebrate species. The difficulty in validly identifying short homologous sequences renders the calculation of an evolutionary rate unreliable. The functionally important aspartate (D) and glutamate (E) residues involved in calcium binding by human Bcl2l10 are marked with asterisks. The locations of the predicted pore-forming α5 and α6 helices are indicated. The LAAS, LAAS*, BCL2L10-α6L, and BCL2L10-α6S peptides used in this study are schematized above the alignment.

The α5–α6 interhelical region of Bcl2l10 has variability in length and in sequence across vertebrate species. (A) Length of the α5–α6 linker of Bcl2l10 in various vertebrates. All sequences were extracted from Ensembl database (version 58). Proposed phylogeny was adapted from Milinkovitch et al. (2010). Ma, million years ago. (B) Multiple sequence alignment of the region located between the predicted α5 and α6 helices of Bcl2l10. Species abbreviations refer to full names given in (A). The α5–α6 connecting region of Bcl2l10 (named LAAS in the human protein) is highly variable in amino acid sequence between vertebrate species. The difficulty in validly identifying short homologous sequences renders the calculation of an evolutionary rate unreliable. The functionally important aspartate (D) and glutamate (E) residues involved in calcium binding by human Bcl2l10 are marked with asterisks. The locations of the predicted pore-forming α5 and α6 helices are indicated. The LAAS, LAAS*, BCL2L10-α6L, and BCL2L10-α6S peptides used in this study are schematized above the alignment.

Bcl2l10 Microstructural Changes Distinctly Impact Cellular Function Toward Apoptosis Regulation

At the structural level, neither the SAAS, at the N-terminus, nor the LAAS additional residues, located between two elements of secondary structure (5th and 6th helices), are expected to modify the global protein fold (see model in fig. 4), as such regions are known to be quite permissive with regards to indels. However, secondary structure predictions using the [email protected] server ( Combet et al. 2000) suggest the possibility of some subtle structural changes ( supplementary fig. S2 , Supplementary Material online). Because the actual structure of membrane-bound or complexed human Bcl2l10 is unknown, making any structural or mechanistic predictions difficult, we sought to identify specific residues in the SAAS and LAAS sequences that may have functional importance. We first asked whether deletion of the SAAS and LAAS regions could impact human Bcl2l10 protein function in apoptosis regulation. For this purpose, recombinant Bcl2l10 constructs harboring a deletion of the first ten amino acids (Nrh, Aouacheria et al. 2001) or missing the segment from amino acids 118 to 133 ( fig. 5A) were assayed by scoring either condensed Hoescht-stained nuclei ( fig. 5B) or Annexin V-positive HeLa cells ( fig. 5C) after treatment with classical apoptosis inducing agents such as thapsigargin or staurosporin. While Bcl2l10 mutants lacking the N-terminal ten amino acids (Δ1–10) retained prosurvival activity at a similar level to the full-length protein ( fig. 5B and C), the mutant lacking the LAAS region lost most of its antiapoptotic ability, irrespective of whether apoptosis is triggered by thapsigargin ( fig. 5C) or by other cell death inducers such as taxol, staurosporin, and tunicamycin (not shown). Although this latter mutant (Δ118–133) did not show reduced mitochondrial localization ( fig. 6), cells expressing pEGFPC1-Bcl2l10Δ118–133 frequently had aggregated GFP fluorescence in the cytoplasm, which may be indicative of structural defects. A more detailed mutational analysis was conducted using Bcl2l10 mutants that included deletions of residues 117–129 and 129–133. As shown in figure 6B, the mutant (▵129–133) deleted for residues 129–133, but not the one lacking amino acids 117–129 (Δ117–129), was deficient in antiapoptotic activity. Furthermore, point mutations involving the negatively charged residues located in this region (E129, E131, D133), or in its close vicinity (D137), decreased the prosurvival effect of human Bcl2l10 ( fig. 5C). Subcellular distribution of the wild-type Bcl2l10 protein and of these mutants fused to GFP was virtually identical ( fig. 6A and not shown). The staining pattern shows a partially diffuse and partially mitochondrial and perinuclear localization consistent with previously published in vitro ( Aouacheria et al. 2001 Ke et al. 2001 Zhang et al. 2001) and in vivo ( Guillemin et al. 2009) results. Taken together, these results reveal that the LAAS region contains a cluster of acidic amino acids that are important for human Bcl2l10 function.

Homology-driven model of human Bcl2l10. The human Bcl2l10 protein (A) has been modeled using M4T ( Fernandez-Fuentes et al. 2007) on the known 3D solution structure of mouse Diva/Boo (B) (pdb code: 2kua, Rautureau et al. 2010). The positions of α5–α6 helices are indicated and BH domains are colored as follows: BH1, orange BH2, purple BH3, yellow BH4, red. Presence of the SAAS region is predicted to extend the BH4-containing first helix (A). In the structural model of human Bcl2l10 (A), a potential calcium-binding domain is localized in the α5–α6 interhelical loop (in cyan) that protrudes from the surface of the more tightly packed portion of the Bcl-2-like globular fold. The negatively charged Asp/Glu residues expected to be involved in calcium binding are colored in deep blue, with side chains shown as sticks and residue numbers indicated. Proposed structure of the SAAS (in green) is consistent with a disordered N-terminal tail. For the published molecular conformation of the mouse Diva/Boo protein (B), the first five residues (GPLGS) were deleted from the original PDB file. Despite the absence of SAAS motif, the N-terminus also appears unstructured and solvent exposed. The interhelical α5–α6 linker is colored cyan.

Homology-driven model of human Bcl2l10. The human Bcl2l10 protein (A) has been modeled using M4T ( Fernandez-Fuentes et al. 2007) on the known 3D solution structure of mouse Diva/Boo (B) (pdb code: 2kua, Rautureau et al. 2010). The positions of α5–α6 helices are indicated and BH domains are colored as follows: BH1, orange BH2, purple BH3, yellow BH4, red. Presence of the SAAS region is predicted to extend the BH4-containing first helix (A). In the structural model of human Bcl2l10 (A), a potential calcium-binding domain is localized in the α5–α6 interhelical loop (in cyan) that protrudes from the surface of the more tightly packed portion of the Bcl-2-like globular fold. The negatively charged Asp/Glu residues expected to be involved in calcium binding are colored in deep blue, with side chains shown as sticks and residue numbers indicated. Proposed structure of the SAAS (in green) is consistent with a disordered N-terminal tail. For the published molecular conformation of the mouse Diva/Boo protein (B), the first five residues (GPLGS) were deleted from the original PDB file. Despite the absence of SAAS motif, the N-terminus also appears unstructured and solvent exposed. The interhelical α5–α6 linker is colored cyan.

Functional evaluation of mutant Bcl2l10 proteins. (A) Schematic representation and expression of the recombinant Bcl2l10 constructs in which deletions or point mutations were introduced. The various Flag- or GFP-tagged fusion proteins are depicted. Western Blot analyses were performed 24-h posttransfection on transiently transfected HeLa cells. Proteins were separated by sodium dodecyl sulfate–polyacrylamide gel electrophoresis followed by immunoblot with anti-Flag or anti-GFP antibody. Nitrocellulose membranes were rehybridized with anti-α-vinculin antibody. Bottom: quantification for relative band intensities of Flag- or GFP-tagged products to vinculin. Quantifications were carried out by densitometric analysis using the Kodak EDA 290 Digital Imaging System and 1D Software Package. (B) Cell death was determined 24-h posttransfection by analyzing anti-Flag immunoreactive HeLa cells (∼250 cells in each experiment) under a fluorescence microscope. Data were compiled from three different fields. Cells were left untreated (−) or were treated for 24 h with dimethyl sulfoxide (control), etoposide (ETO, 10 μM), staurosporin (STS, 1 μM), or thapsigargin (THAP, 10 μM). The mode of cell death, necrosis versus apoptosis, was determined by the cellular permeability to propidium iodide (necrosis) and the morphology of the nuclei after staining with Hoechst 33342 (apoptosis). Propidium iodide–negative cell with condensed or fragmented nuclei were counted as apoptotic. Data are represented as mean ± standard deviation (SD). Results represent the means from three independent experiments. (C) FACS assays of Annexin V staining in HeLa cells transfected with the mutant constructs. Transfected cells were stained for phosphatidylserine exposure 24 h after transfection using Cy3-conjugated Annexin V, and the percentage of apoptotic GFP-expressing cells was determined by FACS. Cells were left untreated (−) or were treated with thapsigargin (10 μM, 24 h). GFP-NRZ and GFP-BFL-1 were used for comparison. Assays were performed in triplicate. Cell death levels are expressed as mean ± SD. *Significant to Δ129–133 P < 0.05. Treatment with taxol, tunicamycin, or staurosporin yielded similar results (not shown).

Functional evaluation of mutant Bcl2l10 proteins. (A) Schematic representation and expression of the recombinant Bcl2l10 constructs in which deletions or point mutations were introduced. The various Flag- or GFP-tagged fusion proteins are depicted. Western Blot analyses were performed 24-h posttransfection on transiently transfected HeLa cells. Proteins were separated by sodium dodecyl sulfate–polyacrylamide gel electrophoresis followed by immunoblot with anti-Flag or anti-GFP antibody. Nitrocellulose membranes were rehybridized with anti-α-vinculin antibody. Bottom: quantification for relative band intensities of Flag- or GFP-tagged products to vinculin. Quantifications were carried out by densitometric analysis using the Kodak EDA 290 Digital Imaging System and 1D Software Package. (B) Cell death was determined 24-h posttransfection by analyzing anti-Flag immunoreactive HeLa cells (∼250 cells in each experiment) under a fluorescence microscope. Data were compiled from three different fields. Cells were left untreated (−) or were treated for 24 h with dimethyl sulfoxide (control), etoposide (ETO, 10 μM), staurosporin (STS, 1 μM), or thapsigargin (THAP, 10 μM). The mode of cell death, necrosis versus apoptosis, was determined by the cellular permeability to propidium iodide (necrosis) and the morphology of the nuclei after staining with Hoechst 33342 (apoptosis). Propidium iodide–negative cell with condensed or fragmented nuclei were counted as apoptotic. Data are represented as mean ± standard deviation (SD). Results represent the means from three independent experiments. (C) FACS assays of Annexin V staining in HeLa cells transfected with the mutant constructs. Transfected cells were stained for phosphatidylserine exposure 24 h after transfection using Cy3-conjugated Annexin V, and the percentage of apoptotic GFP-expressing cells was determined by FACS. Cells were left untreated (−) or were treated with thapsigargin (10 μM, 24 h). GFP-NRZ and GFP-BFL-1 were used for comparison. Assays were performed in triplicate. Cell death levels are expressed as mean ± SD. *Significant to Δ129–133 P < 0.05. Treatment with taxol, tunicamycin, or staurosporin yielded similar results (not shown).

Subcellular localization of wild-type and mutant Bcl2l10 proteins. HeLa cells were cotransfected with mito-DsRed plasmid (encoding DsRed2 fused to the mitochondrial targeting sequence from subunit VIII of human cytochrome c oxidase) and the Flag- or GFP-tagged constructs. Subcellular distribution was analyzed by confocal microscopy 24 h after transfection. DNA dye Topro-3 (blue) was used to visualize nuclei. In merge images (overlay), yellow color shows the colocalization of GFP or Flag fluorescence (green) with mitochondria (red).

Subcellular localization of wild-type and mutant Bcl2l10 proteins. HeLa cells were cotransfected with mito-DsRed plasmid (encoding DsRed2 fused to the mitochondrial targeting sequence from subunit VIII of human cytochrome c oxidase) and the Flag- or GFP-tagged constructs. Subcellular distribution was analyzed by confocal microscopy 24 h after transfection. DNA dye Topro-3 (blue) was used to visualize nuclei. In merge images (overlay), yellow color shows the colocalization of GFP or Flag fluorescence (green) with mitochondria (red).

Interestingly, these negative residues, which are not predicted to be part of the BH3-binding hydrophobic groove of Bcl2l10 ( fig. 4), appear to be strictly conserved in primates ( fig. 3B), whereas being absent (except D137) in other mammals. Given the phyletic distribution of these Asp/Glu residues, we reasoned that positive selection should have operated on the interhelical region to drive their acquisition at the base of the primate lineage, before they became fixed by purifying selection. In order to determine if the negative charge at these positions was involved in conferring some biochemical peculiarity to human Bcl2l10, that is, a favorable characteristic that could be selected for, we carried out extensive similarity searches and sequence motif analysis. We detected that the acidic region EQEGDVARD was bearing resemblance to reported calcium-binding sequences ( Chattopadhyaya et al. 1992 Siedlecka et al. 1999 Shashoua et al. 2003, 2004), and it was thus hypothesized that these residues could be involved in calcium chelation.

Human Bcl2l10 Has Evolved a Novel Calcium-Binding Site

To test the hypothesis that human Bcl2l10 binds to Ca 2+ , standard dot blot 45 Ca–overlay assays were performed. Radiolabeled Ca 2+ was not bound by GST or BSA, was bound robustly by the established Ca 2+ -binding protein calreticulin, and was reproducibly bound by GST-Bcl2l10 ( fig. 7, left, middle, and right panels). Moreover, using the same system, we demonstrated that Nrz-His6 and GST-Nr-13, which are Bcl2l10 orthologous proteins devoid of the LAAS region, were not able to bind 45 Ca 2+ ( fig. 7, left panel). To map the region responsible for the calcium-binding activity of human Bcl2l10, we constructed two mutant genes: a first with an internal deletion whose product was missing the region from residues 118 to 133 and a second encoding amino acid substitutions of selected negatively charged residues in this region (E 131 R/D 133 N). The mutant GST-Bcl2l10 proteins where the LAAS region was deleted (GST-Bcl2l10Δ118–133) or mutated (GST-Bcl2l10[E 131 R/D 133 N]) were successfully produced and purified. Full-length GST-Bcl2l10 and calreticulin, but not GST-BCl2l10Δ118–133 ( fig. 7, left panel) nor GST-Bcl2l10[E 131 R/D 133 N] ( fig. 7, middle panel), bound 45 Ca 2+ . Moreover, while Ca 2+ -binding was detectable for a 26-mer peptide corresponding to the “wild-type” LAAS region of human Bcl2l10 (residues from 115 to 140), a peptide (LAAS*) having the identical point mutations E 131 R/D 133 N, or a control peptide (Bax-BH3) of similar length and containing more Asp and Glu residues (20.6% vs. 15.4% for the LAAS), did not bind Ca 2+ ( fig. 7, middle panel). From this, it is possible to conclude that residues within the LAAS region are crucial for Bcl2l10 binding to Ca 2+ . Moreover, the negatively charged residues important for Bcl2l10 protective activity appear to be required for calcium binding in vitro.

Recombinant Bcl2l10 protein and LAAS peptide bind calcium-45 in vitro. The left and middle panels represent the autoradiographs showing calcium-45 binding and the Ponceau-S-stained blots as sample loading controls. Right panel: Calcium binding was quantified by densitometric analysis followed by normalization based on Ponceau-S staining. Representative data from three individual experiments are presented. Relative binding is indicated (arbitrary units). The indicated polypeptides were directly transferred to nitrocellulose membranes, which were in turn incubated with 45 Ca 2+ , washed, and exposed to film for autoradiography. Approximately 30 μg of recombinant purified GST-wild-type Bcl2l10, GST-Nr-13, Nrz-His6, GST-Bcl2l10Δ118–133, and GST-Bcl2l10[E 131 R/D 133 N] proteins were used along with GST, BSA, and calreticulin (a known calcium-binding protein) as controls. The calcium-45 overlay dot blots were also performed with a synthetic peptide (LAAS) derived from the hypervariable loop of human Bcl2l10, a mutated peptide (LAAS*) incorporating the double amino acid substitution E 131 R/D 133 N, and a peptide that contains the BH3 domain of Bax (BAX-BH3). As expected, the positive control calreticulin (CALR) strongly bound calcium, whereas BSA did not (left and middle panels). The GST-human Bcl2l10 fusion protein reproducibly bound calcium in vitro (left, middle, and left panels), whereas the GST-Bcl2l10Δ118–133 and GST-Bcl2l10[E 131 R/D 133 N] mutant proteins, as well as the homologous chicken GST-Nr-13 and zebrafish Nrz-His6 proteins, which are Bcl2l10 orthologous proteins devoid of LAAS region, did not. Contrary to the BAX-BH3 control peptide, which was defective in calcium binding (middle panel), the LAAS peptide displayed calcium-binding activity (left panel). Amino acid substitutions E 131 R/D 133 N (LAAS*) abolished calcium-binding capacity of this peptide (middle panel).

Recombinant Bcl2l10 protein and LAAS peptide bind calcium-45 in vitro. The left and middle panels represent the autoradiographs showing calcium-45 binding and the Ponceau-S-stained blots as sample loading controls. Right panel: Calcium binding was quantified by densitometric analysis followed by normalization based on Ponceau-S staining. Representative data from three individual experiments are presented. Relative binding is indicated (arbitrary units). The indicated polypeptides were directly transferred to nitrocellulose membranes, which were in turn incubated with 45 Ca 2+ , washed, and exposed to film for autoradiography. Approximately 30 μg of recombinant purified GST-wild-type Bcl2l10, GST-Nr-13, Nrz-His6, GST-Bcl2l10Δ118–133, and GST-Bcl2l10[E 131 R/D 133 N] proteins were used along with GST, BSA, and calreticulin (a known calcium-binding protein) as controls. The calcium-45 overlay dot blots were also performed with a synthetic peptide (LAAS) derived from the hypervariable loop of human Bcl2l10, a mutated peptide (LAAS*) incorporating the double amino acid substitution E 131 R/D 133 N, and a peptide that contains the BH3 domain of Bax (BAX-BH3). As expected, the positive control calreticulin (CALR) strongly bound calcium, whereas BSA did not (left and middle panels). The GST-human Bcl2l10 fusion protein reproducibly bound calcium in vitro (left, middle, and left panels), whereas the GST-Bcl2l10Δ118–133 and GST-Bcl2l10[E 131 R/D 133 N] mutant proteins, as well as the homologous chicken GST-Nr-13 and zebrafish Nrz-His6 proteins, which are Bcl2l10 orthologous proteins devoid of LAAS region, did not. Contrary to the BAX-BH3 control peptide, which was defective in calcium binding (middle panel), the LAAS peptide displayed calcium-binding activity (left panel). Amino acid substitutions E 131 R/D 133 N (LAAS*) abolished calcium-binding capacity of this peptide (middle panel).

Last, we asked whether a peptide corresponding to helix α6 of human Bcl2l10, and which extends a few residues beyond the predicted helical region to incorporate the putative calcium-binding residues, could change its secondary structure in the presence of Ca 2+ . Our CD spectra ( fig. 8A–E) indicate that the folding of this peptide is limited in buffer (small negative shoulder around 220 nm, fig. 8A), and the large negative band around 202 nm indicates a predominance of unfolding. The large intensity decrease of this band upon addition of Ca 2+ indicates some increase of folding. As expected for helix α6, in the presence of sodium dodecyl sulfate (SDS) or trifluoroethanol (TFE) used to probe the conformational preferences of peptides ( Buck 1998 Montserret et al. 2000), the CD spectra were typical of α-helical folding with two minima at 208 and 222 nm ( fig. 8A and B). Addition of Ca 2+ , but not Mg 2+ ( fig. 8D), caused an increase in α-helical content of about one helix turn in the presence of SDS ( fig. 8A) or 50% TFE ( fig. 8B) at physiological pH. In contrast, calcium had no effect at acidic pH (where Asp/Glu residues are expected to be protonated and uncharged) ( fig. 8A) or on a truncated peptide (α6S) lacking the Asp/Glu residues located at the C-terminal end of the LAAS region ( fig. 8E). In addition, intrinsic tryptophan fluorescence of this BCL2L10-α6L peptide was quenched by calcium ions (see supplementary fig. S3 , Supplementary Material online). Thus, a peptide containing the negatively charged residues of the α5–α6 connecting region is structurally responsive to the presence of calcium ions. Moreover, these findings suggest that calcium could induce or stabilize the structure of this BCL2L10 region.

Circular dichroism analysis of a peptide corresponding to helix α6 of Bcl2l10 as a function of TFE and calcium concentration. The conformation in solution of a peptide corresponding to the α6 helix of human Bcl2l10 (BCL2L10-α6L: RLKEQEGDVARDGQRLVALLSSRLMGQHRAWLQA, amino acids 126–159) and comprising the potential calcium-binding residues and of a truncated peptide variant lacking this site (BCL2L10-α6S: RDGQRLVALLSSRLMGQHRAWLQA, amino acids 136–159) was determined by CD spectroscopy. (A) Percent of estimated α-helicity of BCL2L10-α6L in the presence or absence of Ca 2+ and in the membrane-mimicking solvent SDS, at neutral or acidic pH. (B) Effect of calcium ion on the CD spectra. Addition of saturating amounts of CaCl2 enhances helicity of the BCL2L10-α6L peptide in 50% (v/v) TFE. (C) Percent of estimated α-helicity of BCL2L10-α6L in different concentrations of TFE. The addition of TFE increases the α-helicity of the peptide, reaching a plateau at ∼40% TFE. (D) Percent of estimated α-helicity of BCL2L10-α6L in presence of excess amounts of CaCl2 or MgCl2. The α-helicity of the peptide increases by more than 10% in the presence of Ca 2+ (but not Mg 2+ ). (E) Percent of estimated α-helicity of BCL2L10-α6S in presence of excess amounts of CaCl2. Estimated α-helicity of BCL2L10-α6S does not vary in presence of excess amounts of CaCl2.

Circular dichroism analysis of a peptide corresponding to helix α6 of Bcl2l10 as a function of TFE and calcium concentration. The conformation in solution of a peptide corresponding to the α6 helix of human Bcl2l10 (BCL2L10-α6L: RLKEQEGDVARDGQRLVALLSSRLMGQHRAWLQA, amino acids 126–159) and comprising the potential calcium-binding residues and of a truncated peptide variant lacking this site (BCL2L10-α6S: RDGQRLVALLSSRLMGQHRAWLQA, amino acids 136–159) was determined by CD spectroscopy. (A) Percent of estimated α-helicity of BCL2L10-α6L in the presence or absence of Ca 2+ and in the membrane-mimicking solvent SDS, at neutral or acidic pH. (B) Effect of calcium ion on the CD spectra. Addition of saturating amounts of CaCl2 enhances helicity of the BCL2L10-α6L peptide in 50% (v/v) TFE. (C) Percent of estimated α-helicity of BCL2L10-α6L in different concentrations of TFE. The addition of TFE increases the α-helicity of the peptide, reaching a plateau at ∼40% TFE. (D) Percent of estimated α-helicity of BCL2L10-α6L in presence of excess amounts of CaCl2 or MgCl2. The α-helicity of the peptide increases by more than 10% in the presence of Ca 2+ (but not Mg 2+ ). (E) Percent of estimated α-helicity of BCL2L10-α6S in presence of excess amounts of CaCl2. Estimated α-helicity of BCL2L10-α6S does not vary in presence of excess amounts of CaCl2.


Acceleration of protein glycation by oxidative stress and comparative role of antioxidant and protein glycation inhibitor

Hyperglycemia in diabetes causes protein glycation that leads to oxidative stress, release of cytokines, and establishment of secondary complications such as neuropathy, retinopathy, and nephropathy. Several other metabolic disorders, stress, and inflammation generate free radicals and oxidative stress. It is essential to study whether oxidative stress independently enhances protein glycation leading to rapid establishment of secondary complications. Oxidative stress was experimentally induced using rotenone and Fenton reagent for in vivo and in vitro studies, respectively. Results showed significant increase in the rate of modification of BSA in the form of fructosamine and protein-bound carbonyls in the presence of fenton reagent. Circular dichroism studies revealed gross structural changes in the reduction of alpha helix structure and decreased protein surface charge was confirmed by zeta potential studies. Use of rotenone demonstrated enhanced AGE formation, ROS generation, and liver and kidney tissue glycation through fluorescence measurement. Similar findings were also observed in cell culture studies. Use of aminoguanidine, a protein glycation inhibitor, demonstrated reduction in these changes however, a combination of aminoguanidine along with vitamin E demonstrated better amelioration. Thus, oxidative stress accelerates the process of protein glycation causing gross structural changes and tissue glycation in insulin-independent tissues. Use of antioxidants and protein glycation inhibitors in combination are more effective in preventing such changes and could be an effective therapeutic option for preventing establishment of secondary complications of diabetes.

This is a preview of subscription content, access via your institution.